SLC34A1,NAPI-3,NPT2
  • SLC34A1,NAPI-3,NPT2

Anti-SLC34A1 Antibody 100ul

Ref: AN-HPA051255-100ul
Anti-SLC34A1

Información del producto

Polyclonal Antibody against Human SLC34A1, Gene description: solute carrier family 34 (type II sodium/phosphate contransporter), member 1, Alternative Gene Names: NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2, Validated applications: ICC, IHC, Uniprot ID: Q06495, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC34A1
Gene Description solute carrier family 34 (type II sodium/phosphate contransporter), member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Immunogen PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q06495
HTS Code 3002150000
Gene ID 6569
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC34A1 Antibody 100ul

Anti-SLC34A1 Antibody 100ul