CCL21,6Ckine,CKb9
  • CCL21,6Ckine,CKb9

Anti-CCL21 Antibody 25ul

Ref: AN-HPA051210-25ul
Anti-CCL21

Información del producto

Polyclonal Antibody against Human CCL21, Gene description: chemokine (C-C motif) ligand 21, Alternative Gene Names: 6Ckine, CKb9, ECL, exodus-2, SCYA21, SLC, TCA4, Validated applications: IHC, Uniprot ID: O00585, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCL21
Gene Description chemokine (C-C motif) ligand 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT
Immunogen KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 6Ckine, CKb9, ECL, exodus-2, SCYA21, SLC, TCA4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00585
HTS Code 3002150000
Gene ID 6366
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCL21 Antibody 25ul

Anti-CCL21 Antibody 25ul