RASSF2,CENP-34
  • RASSF2,CENP-34

Anti-RASSF2 Antibody 25ul

Ref: AN-HPA051200-25ul
Anti-RASSF2

Información del producto

Polyclonal Antibody against Human RASSF2, Gene description: Ras association (RalGDS/AF-6) domain family member 2, Alternative Gene Names: CENP-34, KIAA0168, Validated applications: ICC, IHC, WB, Uniprot ID: P50749, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RASSF2
Gene Description Ras association (RalGDS/AF-6) domain family member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence QMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHR
Immunogen QMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-34, KIAA0168
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50749
HTS Code 3002150000
Gene ID 9770
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RASSF2 Antibody 25ul

Anti-RASSF2 Antibody 25ul