CYP19A1,ARO,ARO1
  • CYP19A1,ARO,ARO1

Anti-CYP19A1 Antibody 25ul

Ref: AN-HPA051194-25ul
Anti-CYP19A1

Información del producto

Polyclonal Antibody against Human CYP19A1, Gene description: cytochrome P450, family 19, subfamily A, polypeptide 1, Alternative Gene Names: ARO, ARO1, aromatase, CPV1, CYAR, CYP19, P-450AROM, Validated applications: ICC, IHC, Uniprot ID: P11511, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYP19A1
Gene Description cytochrome P450, family 19, subfamily A, polypeptide 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL
Immunogen IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARO, ARO1, aromatase, CPV1, CYAR, CYP19, P-450AROM
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11511
HTS Code 3002150000
Gene ID 1588
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYP19A1 Antibody 25ul

Anti-CYP19A1 Antibody 25ul