NCOR1,hCIT529I10
  • NCOR1,hCIT529I10

Anti-NCOR1 Antibody 25ul

Ref: AN-HPA051168-25ul
Anti-NCOR1

Información del producto

Polyclonal Antibody against Human NCOR1, Gene description: nuclear receptor corepressor 1, Alternative Gene Names: hCIT529I10, hN-CoR, KIAA1047, MGC104216, N-CoR, PPP1R109, TRAC1, Validated applications: ICC, IHC, Uniprot ID: O75376, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NCOR1
Gene Description nuclear receptor corepressor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ
Immunogen PPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hCIT529I10, hN-CoR, KIAA1047, MGC104216, N-CoR, PPP1R109, TRAC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75376
HTS Code 3002150000
Gene ID 9611
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NCOR1 Antibody 25ul

Anti-NCOR1 Antibody 25ul