EID1,C15orf3,CRI1
  • EID1,C15orf3,CRI1

Anti-EID1 Antibody 25ul

Ref: AN-HPA051123-25ul
Anti-EID1

Información del producto

Polyclonal Antibody against Human EID1, Gene description: EP300 interacting inhibitor of differentiation 1, Alternative Gene Names: C15orf3, CRI1, EID-1, Validated applications: IHC, Uniprot ID: Q9Y6B2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EID1
Gene Description EP300 interacting inhibitor of differentiation 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEI
Immunogen DEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C15orf3, CRI1, EID-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6B2
HTS Code 3002150000
Gene ID 23741
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EID1 Antibody 25ul

Anti-EID1 Antibody 25ul