CALML4,MGC4809
  • CALML4,MGC4809

Anti-CALML4 Antibody 100ul

Ref: AN-HPA051109-100ul
Anti-CALML4

Información del producto

Polyclonal Antibody against Human CALML4, Gene description: calmodulin-like 4, Alternative Gene Names: MGC4809, NY-BR-20, Validated applications: ICC, IHC, Uniprot ID: Q96GE6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CALML4
Gene Description calmodulin-like 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY
Immunogen LLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC4809, NY-BR-20
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GE6
HTS Code 3002150000
Gene ID 91860
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CALML4 Antibody 100ul

Anti-CALML4 Antibody 100ul