ZNF524,MGC23143
  • ZNF524,MGC23143

Anti-ZNF524 Antibody 25ul

Ref: AN-HPA050981-25ul
Anti-ZNF524

Información del producto

Polyclonal Antibody against Human ZNF524, Gene description: zinc finger protein 524, Alternative Gene Names: MGC23143, Validated applications: ICC, IHC, WB, Uniprot ID: Q96C55, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF524
Gene Description zinc finger protein 524
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence CRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATA
Immunogen CRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC23143
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96C55
HTS Code 3002150000
Gene ID 147807
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF524 Antibody 25ul

Anti-ZNF524 Antibody 25ul