AVL9,KIAA0241
  • AVL9,KIAA0241

Anti-AVL9 Antibody 100ul

Ref: AN-HPA050957-100ul
Anti-AVL9

Información del producto

Polyclonal Antibody against Human AVL9, Gene description: AVL9 homolog (S. cerevisiase), Alternative Gene Names: KIAA0241, Validated applications: ICC, IHC, Uniprot ID: Q8NBF6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AVL9
Gene Description AVL9 homolog (S. cerevisiase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGNVMVTTSRNVVQTGKAVGQSVGGAFSSAKTAMSSWLSTFTTSTSQSLTEPPDE
Immunogen PNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGNVMVTTSRNVVQTGKAVGQSVGGAFSSAKTAMSSWLSTFTTSTSQSLTEPPDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0241
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NBF6
HTS Code 3002150000
Gene ID 23080
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AVL9 Antibody 100ul

Anti-AVL9 Antibody 100ul