CYSTM1,C5orf32
  • CYSTM1,C5orf32

Anti-CYSTM1 Antibody 25ul

Ref: AN-HPA050930-25ul
Anti-CYSTM1

Información del producto

Polyclonal Antibody against Human CYSTM1, Gene description: cysteine-rich transmembrane module containing 1, Alternative Gene Names: C5orf32, ORF1-FL49, Validated applications: IHC, Uniprot ID: Q9H1C7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYSTM1
Gene Description cysteine-rich transmembrane module containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG
Immunogen QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C5orf32, ORF1-FL49
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1C7
HTS Code 3002150000
Gene ID 84418
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYSTM1 Antibody 25ul

Anti-CYSTM1 Antibody 25ul