TET3,hCG_40738
  • TET3,hCG_40738

Anti-TET3 Antibody 100ul

Ref: AN-HPA050845-100ul
Anti-TET3

Información del producto

Polyclonal Antibody against Human TET3, Gene description: tet methylcytosine dioxygenase 3, Alternative Gene Names: hCG_40738, MGC22014, Validated applications: ICC, IHC, Uniprot ID: O43151, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TET3
Gene Description tet methylcytosine dioxygenase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
Immunogen SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hCG_40738, MGC22014
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43151
HTS Code 3002150000
Gene ID 200424
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TET3 Antibody 100ul

Anti-TET3 Antibody 100ul