SLC7A6,KIAA0245
  • SLC7A6,KIAA0245

Anti-SLC7A6 Antibody 100ul

Ref: AN-HPA050713-100ul
Anti-SLC7A6

Información del producto

Polyclonal Antibody against Human SLC7A6, Gene description: solute carrier family 7 (amino acid transporter light chain, y+L system), member 6, Alternative Gene Names: KIAA0245, LAT-2, LAT3, y+LAT-2, Validated applications: ICC, IHC, Uniprot ID: Q92536, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC7A6
Gene Description solute carrier family 7 (amino acid transporter light chain, y+L system), member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
Immunogen MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0245, LAT-2, LAT3, y+LAT-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92536
HTS Code 3002150000
Gene ID 9057
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC7A6 Antibody 100ul

Anti-SLC7A6 Antibody 100ul