CASP2,ICH1,MGC2181
  • CASP2,ICH1,MGC2181

Anti-CASP2 Antibody 25ul

Ref: AN-HPA050678-25ul
Anti-CASP2

Información del producto

Polyclonal Antibody against Human CASP2, Gene description: caspase 2, apoptosis-related cysteine peptidase, Alternative Gene Names: ICH1, MGC2181, NEDD2, PPP1R57, Validated applications: ICC, IHC, Uniprot ID: P42575, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CASP2
Gene Description caspase 2, apoptosis-related cysteine peptidase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTG
Immunogen VELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ICH1, MGC2181, NEDD2, PPP1R57
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P42575
HTS Code 3002150000
Gene ID 835
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CASP2 Antibody 25ul

Anti-CASP2 Antibody 25ul