IGFBP1,AFBP
  • IGFBP1,AFBP

Anti-IGFBP1 Antibody 100ul

Ref: AN-HPA050640-100ul
Anti-IGFBP1

Información del producto

Polyclonal Antibody against Human IGFBP1, Gene description: insulin-like growth factor binding protein 1, Alternative Gene Names: AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12, Validated applications: IHC, Uniprot ID: P08833, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGFBP1
Gene Description insulin-like growth factor binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI
Immunogen SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P08833
HTS Code 3002150000
Gene ID 3484
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IGFBP1 Antibody 100ul

Anti-IGFBP1 Antibody 100ul