WDFY1,FENS-1
  • WDFY1,FENS-1

Anti-WDFY1 Antibody 25ul

Ref: AN-HPA050603-25ul
Anti-WDFY1

Información del producto

Polyclonal Antibody against Human WDFY1, Gene description: WD repeat and FYVE domain containing 1, Alternative Gene Names: FENS-1, KIAA1435, WDF1, ZFYVE17, Validated applications: IHC, WB, Uniprot ID: Q8IWB7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDFY1
Gene Description WD repeat and FYVE domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGH
Immunogen SIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FENS-1, KIAA1435, WDF1, ZFYVE17
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWB7
HTS Code 3002150000
Gene ID 57590
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WDFY1 Antibody 25ul

Anti-WDFY1 Antibody 25ul