SFRP4,FRP-4,frpHE
  • SFRP4,FRP-4,frpHE

Anti-SFRP4 Antibody 100ul

Ref: AN-HPA050585-100ul
Anti-SFRP4

Información del producto

Polyclonal Antibody against Human SFRP4, Gene description: secreted frizzled-related protein 4, Alternative Gene Names: FRP-4, frpHE, Validated applications: IHC, WB, Uniprot ID: Q6FHJ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SFRP4
Gene Description secreted frizzled-related protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPK
Immunogen PTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FRP-4, frpHE
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6FHJ7
HTS Code 3002150000
Gene ID 6424
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SFRP4 Antibody 100ul

Anti-SFRP4 Antibody 100ul