HSD3B7
  • HSD3B7

Anti-HSD3B7 Antibody 100ul

Ref: AN-HPA050521-100ul
Anti-HSD3B7

Información del producto

Polyclonal Antibody against Human HSD3B7, Gene description: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7, Alternative Gene Names: C(27)-3BETA-HSD, SDR11E3, Validated applications: ICC, IHC, Uniprot ID: Q9H2F3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HSD3B7
Gene Description hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG
Immunogen VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C(27)-3BETA-HSD, SDR11E3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2F3
HTS Code 3002150000
Gene ID 80270
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSD3B7 Antibody 100ul

Anti-HSD3B7 Antibody 100ul