STEAP3,dudlin-2
  • STEAP3,dudlin-2

Anti-STEAP3 Antibody 100ul

Ref: AN-HPA050510-100ul
Anti-STEAP3

Información del producto

Polyclonal Antibody against Human STEAP3, Gene description: STEAP family member 3, metalloreductase, Alternative Gene Names: dudlin-2, STMP3, TSAP6, Validated applications: ICC, IHC, WB, Uniprot ID: Q658P3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STEAP3
Gene Description STEAP family member 3, metalloreductase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE
Immunogen PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dudlin-2, STMP3, TSAP6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q658P3
HTS Code 3002150000
Gene ID 55240
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STEAP3 Antibody 100ul

Anti-STEAP3 Antibody 100ul