EPX,EPO,EPP,EPX-PEN
  • EPX,EPO,EPP,EPX-PEN

Anti-EPX Antibody 25ul

Ref: AN-HPA050507-25ul
Anti-EPX

Información del producto

Polyclonal Antibody against Human EPX, Gene description: eosinophil peroxidase, Alternative Gene Names: EPO, EPP, EPX-PEN, Validated applications: WB, Uniprot ID: P11678, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EPX
Gene Description eosinophil peroxidase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS
Immunogen EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EPO, EPP, EPX-PEN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11678
HTS Code 3002150000
Gene ID 8288
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EPX Antibody 25ul

Anti-EPX Antibody 25ul