TMEM38A,MGC3169
  • TMEM38A,MGC3169

Anti-TMEM38A Antibody 100ul

Ref: AN-HPA050463-100ul
Anti-TMEM38A

Información del producto

Polyclonal Antibody against Human TMEM38A, Gene description: transmembrane protein 38A, Alternative Gene Names: MGC3169, TRIC-A, Validated applications: IHC, WB, Uniprot ID: Q9H6F2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM38A
Gene Description transmembrane protein 38A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK
Immunogen THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC3169, TRIC-A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H6F2
HTS Code 3002150000
Gene ID 79041
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMEM38A Antibody 100ul

Anti-TMEM38A Antibody 100ul