JAM3,JAM-C,JAMC
  • JAM3,JAM-C,JAMC

Anti-JAM3 Antibody 100ul

Ref: AN-HPA050434-100ul
Anti-JAM3

Información del producto

Polyclonal Antibody against Human JAM3, Gene description: junctional adhesion molecule 3, Alternative Gene Names: JAM-C, JAMC, Validated applications: ICC, WB, Uniprot ID: Q9BX67, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name JAM3
Gene Description junctional adhesion molecule 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence SATLDMALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKI
Immunogen SATLDMALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names JAM-C, JAMC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BX67
HTS Code 3002150000
Gene ID 83700
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-JAM3 Antibody 100ul

Anti-JAM3 Antibody 100ul