IGFN1,DKFZp434B1231
  • IGFN1,DKFZp434B1231

Anti-IGFN1 Antibody 100ul

Ref: AN-HPA050415-100ul
Anti-IGFN1

Información del producto

Polyclonal Antibody against Human IGFN1, Gene description: immunoglobulin-like and fibronectin type III domain containing 1, Alternative Gene Names: DKFZp434B1231, EEF1A2BP1, Validated applications: ICC, IHC, Uniprot ID: Q86VF2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGFN1
Gene Description immunoglobulin-like and fibronectin type III domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA
Immunogen AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434B1231, EEF1A2BP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86VF2
HTS Code 3002150000
Gene ID 91156
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IGFN1 Antibody 100ul

Anti-IGFN1 Antibody 100ul