NANP,C20orf147
  • NANP,C20orf147

Anti-NANP Antibody 25ul

Ref: AN-HPA050342-25ul
Anti-NANP

Información del producto

Polyclonal Antibody against Human NANP, Gene description: N-acetylneuraminic acid phosphatase, Alternative Gene Names: C20orf147, dJ694B14.3, HDHD4, MGC26833, Validated applications: ICC, IHC, WB, Uniprot ID: Q8TBE9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NANP
Gene Description N-acetylneuraminic acid phosphatase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence NRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGD
Immunogen NRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf147, dJ694B14.3, HDHD4, MGC26833
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBE9
HTS Code 3002150000
Gene ID 140838
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NANP Antibody 25ul

Anti-NANP Antibody 25ul