MIER1,hMI-ER1
  • MIER1,hMI-ER1

Anti-MIER1 Antibody 25ul

Ref: AN-HPA050306-25ul
Anti-MIER1

Información del producto

Polyclonal Antibody against Human MIER1, Gene description: mesoderm induction early response 1, transcriptional regulator, Alternative Gene Names: hMI-ER1, KIAA1610, MI-ER1, Validated applications: ICC, Uniprot ID: Q8N108, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MIER1
Gene Description mesoderm induction early response 1, transcriptional regulator
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD
Immunogen GPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hMI-ER1, KIAA1610, MI-ER1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N108
HTS Code 3002150000
Gene ID 57708
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MIER1 Antibody 25ul

Anti-MIER1 Antibody 25ul