NT5C1A,CN-I,CN-IA
  • NT5C1A,CN-I,CN-IA

Anti-NT5C1A Antibody 25ul

Ref: AN-HPA050283-25ul
Anti-NT5C1A

Información del producto

Polyclonal Antibody against Human NT5C1A, Gene description: 5'-nucleotidase, cytosolic IA, Alternative Gene Names: CN-I, CN-IA, CN1, CN1A, MGC119199, MGC119201, Validated applications: IHC, Uniprot ID: Q9BXI3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NT5C1A
Gene Description 5'-nucleotidase, cytosolic IA
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGP
Immunogen PVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CN-I, CN-IA, CN1, CN1A, MGC119199, MGC119201
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXI3
HTS Code 3002150000
Gene ID 84618
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NT5C1A Antibody 25ul

Anti-NT5C1A Antibody 25ul