CLEC7A,CD369
  • CLEC7A,CD369

Anti-CLEC7A Antibody 100ul

Ref: AN-HPA050229-100ul
Anti-CLEC7A

Información del producto

Polyclonal Antibody against Human CLEC7A, Gene description: C-type lectin domain family 7, member A, Alternative Gene Names: CD369, CLECSF12, dectin-1, hDectin-1, Validated applications: ICC, WB, Uniprot ID: Q9BXN2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLEC7A
Gene Description C-type lectin domain family 7, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence DSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFS
Immunogen DSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD369, CLECSF12, dectin-1, hDectin-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXN2
HTS Code 3002150000
Gene ID 64581
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLEC7A Antibody 100ul

Anti-CLEC7A Antibody 100ul