EIF3C,eIF3-p110
  • EIF3C,eIF3-p110

Anti-EIF3C Antibody 25ul

Ref: AN-HPA050112-25ul
Anti-EIF3C

Información del producto

Polyclonal Antibody against Human EIF3C, Gene description: eukaryotic translation initiation factor 3, subunit C, Alternative Gene Names: eIF3-p110, eIF3c, EIF3S8, Validated applications: IHC, WB, Uniprot ID: Q99613, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF3C
Gene Description eukaryotic translation initiation factor 3, subunit C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE
Immunogen NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eIF3-p110, eIF3c, EIF3S8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99613
HTS Code 3002150000
Gene ID 8663
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF3C Antibody 25ul

Anti-EIF3C Antibody 25ul