C4A,C4,C4A2,C4A3
  • C4A,C4,C4A2,C4A3

Anti-C4A Antibody 25ul

Ref: AN-HPA050103-25ul
Anti-C4A

Información del producto

Polyclonal Antibody against Human C4A, Gene description: complement component 4A (Rodgers blood group), Alternative Gene Names: C4, C4A2, C4A3, C4A4, C4A6, C4B, C4S, CO4, CPAMD2, RG, Validated applications: IHC, Uniprot ID: P0C0L4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C4A
Gene Description complement component 4A (Rodgers blood group)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG
Immunogen LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4, C4A2, C4A3, C4A4, C4A6, C4B, C4S, CO4, CPAMD2, RG
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0C0L4
HTS Code 3002150000
Gene ID 720
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C4A Antibody 25ul

Anti-C4A Antibody 25ul