CD80,B7-1,B7.1
  • CD80,B7-1,B7.1

Anti-CD80 Antibody 100ul

Ref: AN-HPA050092-100ul
Anti-CD80

Información del producto

Polyclonal Antibody against Human CD80, Gene description: CD80 molecule, Alternative Gene Names: B7-1, B7.1, CD28LG, CD28LG1, Validated applications: IHC, WB, Uniprot ID: P33681, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CD80
Gene Description CD80 molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG
Immunogen YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B7-1, B7.1, CD28LG, CD28LG1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P33681
HTS Code 3002150000
Gene ID 941
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CD80 Antibody 100ul

Anti-CD80 Antibody 100ul