FAM83C,C20orf128
  • FAM83C,C20orf128

Anti-FAM83C Antibody 100ul

Ref: AN-HPA049978-100ul
Anti-FAM83C

Información del producto

Polyclonal Antibody against Human FAM83C, Gene description: family with sequence similarity 83, member C, Alternative Gene Names: C20orf128, dJ614O4.7, Validated applications: IHC, Uniprot ID: Q9BQN1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM83C
Gene Description family with sequence similarity 83, member C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VGDPDSGVTPNSGPLRPGEQAPEDRRLSPSQADSQLDLLSRALGTGGAPELGSLRPGDRALEDRRLSLNQSRGQSDLLMQYPKAQGSRVPLETNSSARP
Immunogen VGDPDSGVTPNSGPLRPGEQAPEDRRLSPSQADSQLDLLSRALGTGGAPELGSLRPGDRALEDRRLSLNQSRGQSDLLMQYPKAQGSRVPLETNSSARP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf128, dJ614O4.7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQN1
HTS Code 3002150000
Gene ID 128876
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM83C Antibody 100ul

Anti-FAM83C Antibody 100ul