ZNF211,CH2H2-25
  • ZNF211,CH2H2-25

Anti-ZNF211 Antibody 25ul

Ref: AN-HPA049967-25ul
Anti-ZNF211

Información del producto

Polyclonal Antibody against Human ZNF211, Gene description: zinc finger protein 211, Alternative Gene Names: CH2H2-25, ZNF-25, Validated applications: ICC, Uniprot ID: Q13398, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF211
Gene Description zinc finger protein 211
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SCIVHVSEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQ
Immunogen SCIVHVSEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CH2H2-25, ZNF-25
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13398
HTS Code 3002150000
Gene ID 10520
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF211 Antibody 25ul

Anti-ZNF211 Antibody 25ul