DESI2,C1orf121
  • DESI2,C1orf121

Anti-DESI2 Antibody 25ul

Ref: AN-HPA049950-25ul
Anti-DESI2

Información del producto

Polyclonal Antibody against Human DESI2, Gene description: desumoylating isopeptidase 2, Alternative Gene Names: C1orf121, CGI-146, FAM152A, FLJ21998, PNAS-4, PPPDE1, Validated applications: ICC, Uniprot ID: Q9BSY9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DESI2
Gene Description desumoylating isopeptidase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
Immunogen VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf121, CGI-146, FAM152A, FLJ21998, PNAS-4, PPPDE1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BSY9
HTS Code 3002150000
Gene ID 51029
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DESI2 Antibody 25ul

Anti-DESI2 Antibody 25ul