BCL7B
  • BCL7B

Anti-BCL7B Antibody 25ul

Ref: AN-HPA049943-25ul
Anti-BCL7B

Información del producto

Polyclonal Antibody against Human BCL7B, Gene description: B-cell CLL/lymphoma 7B, Validated applications: ICC, Uniprot ID: Q9BQE9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BCL7B
Gene Description B-cell CLL/lymphoma 7B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Immunogen LTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQE9
HTS Code 3002150000
Gene ID 9275
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCL7B Antibody 25ul

Anti-BCL7B Antibody 25ul