RNF144A,KIAA0161
  • RNF144A,KIAA0161

Anti-RNF144A Antibody 25ul

Ref: AN-HPA049939-25ul
Anti-RNF144A

Información del producto

Polyclonal Antibody against Human RNF144A, Gene description: ring finger protein 144A, Alternative Gene Names: KIAA0161, RNF144, UBCE7IP4, Validated applications: ICC, IHC, Uniprot ID: P50876, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF144A
Gene Description ring finger protein 144A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
Immunogen CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0161, RNF144, UBCE7IP4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50876
HTS Code 3002150000
Gene ID 9781
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RNF144A Antibody 25ul

Anti-RNF144A Antibody 25ul