ZKSCAN7,FLJ12738
  • ZKSCAN7,FLJ12738

Anti-ZKSCAN7 Antibody 100ul

Ref: AN-HPA049906-100ul
Anti-ZKSCAN7

Información del producto

Polyclonal Antibody against Human ZKSCAN7, Gene description: zinc finger with KRAB and SCAN domains 7, Alternative Gene Names: FLJ12738, ZNF167, ZNF448, ZNF64, ZSCAN39, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P0L1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZKSCAN7
Gene Description zinc finger with KRAB and SCAN domains 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence PAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAG
Immunogen PAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12738, ZNF167, ZNF448, ZNF64, ZSCAN39
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0L1
HTS Code 3002150000
Gene ID 55888
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZKSCAN7 Antibody 100ul

Anti-ZKSCAN7 Antibody 100ul