DDHD1,KIAA1705
  • DDHD1,KIAA1705

Anti-DDHD1 Antibody 100ul

Ref: AN-HPA049870-100ul
Anti-DDHD1

Información del producto

Polyclonal Antibody against Human DDHD1, Gene description: DDHD domain containing 1, Alternative Gene Names: KIAA1705, PA-PLA1, SPG28, Validated applications: IHC, WB, Uniprot ID: Q8NEL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DDHD1
Gene Description DDHD domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPD
Immunogen NTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1705, PA-PLA1, SPG28
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NEL9
HTS Code 3002150000
Gene ID 80821
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DDHD1 Antibody 100ul

Anti-DDHD1 Antibody 100ul