CCL1,I-309,P500
  • CCL1,I-309,P500

Anti-CCL1 Antibody 25ul

Ref: AN-HPA049861-25ul
Anti-CCL1

Información del producto

Polyclonal Antibody against Human CCL1, Gene description: chemokine (C-C motif) ligand 1, Alternative Gene Names: I-309, P500, SCYA1, SISe, TCA3, Validated applications: IHC, Uniprot ID: P22362, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCL1
Gene Description chemokine (C-C motif) ligand 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS
Immunogen RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names I-309, P500, SCYA1, SISe, TCA3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22362
HTS Code 3002150000
Gene ID 6346
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCL1 Antibody 25ul

Anti-CCL1 Antibody 25ul