ZGLP1,GATAD3,GLP-1
  • ZGLP1,GATAD3,GLP-1

Anti-ZGLP1 Antibody 25ul

Ref: AN-HPA049855-25ul
Anti-ZGLP1

Información del producto

Polyclonal Antibody against Human ZGLP1, Gene description: zinc finger, GATA-like protein 1, Alternative Gene Names: GATAD3, GLP-1, GLP1, Validated applications: ICC, IHC, Uniprot ID: P0C6A0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZGLP1
Gene Description zinc finger, GATA-like protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQE
Immunogen LLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GATAD3, GLP-1, GLP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0C6A0
HTS Code 3002150000
Gene ID 100125288
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZGLP1 Antibody 25ul

Anti-ZGLP1 Antibody 25ul