POM121
  • POM121

Anti-POM121 Antibody 25ul

Ref: AN-HPA049817-25ul
Anti-POM121

Información del producto

Polyclonal Antibody against Human POM121, Gene description: POM121 transmembrane nucleoporin, Alternative Gene Names: DKFZP586G1822, DKFZP586P2220, KIAA0618, POM121A, Validated applications: ICC, IHC, Uniprot ID: Q96HA1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POM121
Gene Description POM121 transmembrane nucleoporin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKK
Immunogen MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP586G1822, DKFZP586P2220, KIAA0618, POM121A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96HA1
HTS Code 3002150000
Gene ID 9883
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POM121 Antibody 25ul

Anti-POM121 Antibody 25ul