TCF3,bHLHb21,E2A
  • TCF3,bHLHb21,E2A

Anti-TCF3 Antibody 25ul

Ref: AN-HPA049808-25ul
Anti-TCF3

Información del producto

Polyclonal Antibody against Human TCF3, Gene description: transcription factor 3, Alternative Gene Names: bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR, Validated applications: ICC, IHC, Uniprot ID: P15923, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCF3
Gene Description transcription factor 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
Immunogen RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P15923
HTS Code 3002150000
Gene ID 6929
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TCF3 Antibody 25ul

Anti-TCF3 Antibody 25ul