ZC3H14,FLJ11806
  • ZC3H14,FLJ11806

Anti-ZC3H14 Antibody 100ul

Ref: AN-HPA049798-100ul
Anti-ZC3H14

Información del producto

Polyclonal Antibody against Human ZC3H14, Gene description: zinc finger CCCH-type containing 14, Alternative Gene Names: FLJ11806, NY-REN-37, UKp68, Validated applications: ICC, IHC, WB, Uniprot ID: Q6PJT7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZC3H14
Gene Description zinc finger CCCH-type containing 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVK
Immunogen RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11806, NY-REN-37, UKp68
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PJT7
HTS Code 3002150000
Gene ID 79882
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZC3H14 Antibody 100ul

Anti-ZC3H14 Antibody 100ul