KRT81,Hb-1,KRTHB1
  • KRT81,Hb-1,KRTHB1

Anti-KRT81 Antibody 25ul

Ref: AN-HPA049778-25ul
Anti-KRT81

Información del producto

Polyclonal Antibody against Human KRT81, Gene description: keratin 81, type II, Alternative Gene Names: Hb-1, KRTHB1, Validated applications: IHC, Uniprot ID: Q14533, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KRT81
Gene Description keratin 81, type II
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
Immunogen AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Hb-1, KRTHB1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14533
HTS Code 3002150000
Gene ID 3887
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KRT81 Antibody 25ul

Anti-KRT81 Antibody 25ul