NOL7,C6orf90
  • NOL7,C6orf90

Anti-NOL7 Antibody 100ul

Ref: AN-HPA049693-100ul
Anti-NOL7

Información del producto

Polyclonal Antibody against Human NOL7, Gene description: nucleolar protein 7, 27kDa, Alternative Gene Names: C6orf90, dJ223E5.2, NOP27, PQBP3, RARG-1, Validated applications: ICC, Uniprot ID: Q9UMY1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NOL7
Gene Description nucleolar protein 7, 27kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFL
Immunogen SPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf90, dJ223E5.2, NOP27, PQBP3, RARG-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UMY1
HTS Code 3002150000
Gene ID 51406
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NOL7 Antibody 100ul

Anti-NOL7 Antibody 100ul