HYAL3,LUCA-3,LUCA14
  • HYAL3,LUCA-3,LUCA14

Anti-HYAL3 Antibody 100ul

Ref: AN-HPA049402-100ul
Anti-HYAL3

Información del producto

Polyclonal Antibody against Human HYAL3, Gene description: hyaluronoglucosaminidase 3, Alternative Gene Names: LUCA-3, LUCA14, Minna14, Validated applications: IHC, WB, Uniprot ID: O43820, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HYAL3
Gene Description hyaluronoglucosaminidase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence AAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALR
Immunogen AAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LUCA-3, LUCA14, Minna14
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43820
HTS Code 3002150000
Gene ID 8372
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HYAL3 Antibody 100ul

Anti-HYAL3 Antibody 100ul