CAV1,CAV
  • CAV1,CAV

Anti-CAV1 Antibody 100ul

Ref: AN-HPA049326-100ul
Anti-CAV1

Información del producto

Polyclonal Antibody against Human CAV1, Gene description: caveolin 1, caveolae protein, 22kDa, Alternative Gene Names: CAV, Validated applications: IHC, WB, Uniprot ID: Q03135, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CAV1
Gene Description caveolin 1, caveolae protein, 22kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Immunogen LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAV
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q03135
HTS Code 3002150000
Gene ID 857
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CAV1 Antibody 100ul

Anti-CAV1 Antibody 100ul