EIF3F,eIF3-epsilon
  • EIF3F,eIF3-epsilon

Anti-EIF3F Antibody 25ul

Ref: AN-HPA049250-25ul
Anti-EIF3F

Información del producto

Polyclonal Antibody against Human EIF3F, Gene description: eukaryotic translation initiation factor 3, subunit F, Alternative Gene Names: eIF3-epsilon, eIF3-p47, eIF3f, EIF3S5, Validated applications: IHC, WB, Uniprot ID: O00303, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF3F
Gene Description eukaryotic translation initiation factor 3, subunit F
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYA
Immunogen DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eIF3-epsilon, eIF3-p47, eIF3f, EIF3S5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00303
HTS Code 3002150000
Gene ID 8665
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF3F Antibody 25ul

Anti-EIF3F Antibody 25ul