PRSS22,BSSP-4
  • PRSS22,BSSP-4

Anti-PRSS22 Antibody 100ul

Ref: AN-HPA049161-100ul
Anti-PRSS22

Información del producto

Polyclonal Antibody against Human PRSS22, Gene description: protease, serine, 22, Alternative Gene Names: BSSP-4, hBSSP-4, SP001LA, Validated applications: ICC, IHC, Uniprot ID: Q9GZN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PRSS22
Gene Description protease, serine, 22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV
Immunogen AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BSSP-4, hBSSP-4, SP001LA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9GZN4
HTS Code 3002150000
Gene ID 64063
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PRSS22 Antibody 100ul

Anti-PRSS22 Antibody 100ul