DPYSL4,DRP-4,ULIP4
  • DPYSL4,DRP-4,ULIP4

Anti-DPYSL4 Antibody 100ul

Ref: AN-HPA049066-100ul
Anti-DPYSL4

Información del producto

Polyclonal Antibody against Human DPYSL4, Gene description: dihydropyrimidinase-like 4, Alternative Gene Names: DRP-4, ULIP4, Validated applications: ICC, IHC, WB, Uniprot ID: O14531, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DPYSL4
Gene Description dihydropyrimidinase-like 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence YDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLH
Immunogen YDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DRP-4, ULIP4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14531
HTS Code 3002150000
Gene ID 10570
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DPYSL4 Antibody 100ul

Anti-DPYSL4 Antibody 100ul