SGSM3,DJ1042K10.2
  • SGSM3,DJ1042K10.2

Anti-SGSM3 Antibody 25ul

Ref: AN-HPA048980-25ul
Anti-SGSM3

Información del producto

Polyclonal Antibody against Human SGSM3, Gene description: small G protein signaling modulator 3, Alternative Gene Names: DJ1042K10.2, RabGAP-5, RABGAP5, RUSC3, RUTBC3, Validated applications: ICC, IHC, WB, Uniprot ID: Q96HU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SGSM3
Gene Description small G protein signaling modulator 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence PFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLP
Immunogen PFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DJ1042K10.2, RabGAP-5, RABGAP5, RUSC3, RUTBC3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96HU1
HTS Code 3002150000
Gene ID 27352
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SGSM3 Antibody 25ul

Anti-SGSM3 Antibody 25ul