FAM69C,C18orf51
  • FAM69C,C18orf51

Anti-FAM69C Antibody 25ul

Ref: AN-HPA048928-25ul
Anti-FAM69C

Información del producto

Polyclonal Antibody against Human FAM69C, Gene description: family with sequence similarity 69, member C, Alternative Gene Names: C18orf51, Validated applications: IHC, Uniprot ID: Q0P6D2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM69C
Gene Description family with sequence similarity 69, member C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTGDEDCNFFDCF
Immunogen LSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTGDEDCNFFDCF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C18orf51
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q0P6D2
HTS Code 3002150000
Gene ID 125704
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM69C Antibody 25ul

Anti-FAM69C Antibody 25ul